PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00016g01526.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 413aa    MW: 45946.2 Da    PI: 8.3428
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00016g01526.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.85e-33268323156
                   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                               k+r++W+peLH+rFv+a++qLGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Peaxi162Scf00016g01526.1 268 KQRRCWSPELHRRFVDALQQLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 323
                               79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.584265325IPR017930Myb domain
SuperFamilySSF466893.81E-18266326IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.7E-30266326IPR009057Homeodomain-like
TIGRFAMsTIGR015575.6E-27268323IPR006447Myb domain, plants
PfamPF002495.1E-8270321IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MGSIPHELSL DCKPSFIPTS VTDFLKQVSL IHNIPDKVSR IDDYITKLED EMRKIDAFKR  60
ELPLCVLLVK DAIVALRAES VQYSKSRIEP VLEEFIPLKK SSNEDNNTNK ADEVKKDKDS  120
REKMSWMSSV QLWNSEPQYQ DIDEANNKQR SKSELKMRSP EEGNSSITED PFQSCKTVNV  180
GKAFSPFKGF SSFSVTTAVR KDDKDELPGV PGLSLHTPGI TKLREDTVTS GLNSKHIGNR  240
GGLSSVASSH QSNVRTGSLA QQQQNARKQR RCWSPELHRR FVDALQQLGG SQVATPKQIR  300
ELMQVDGLTN DEVKSHLQKY RLHTRRLPNS QSQPANQSGV ALGNLWLSHD QYGESSKHSS  360
SQSGSPQGPL HLGGSSRGTS TTVGDSMEEE DDVKSESTHS WKNHTHSSGK IVV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015062924.10.0PREDICTED: uncharacterized protein LOC107008410
TrEMBLK4B3460.0K4B346_SOLLC; Uncharacterized protein
STRINGSolyc01g108300.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43612443
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.12e-54G2-like family protein